OPN1SW Rabbit Polyclonal Antibody

SKU TA342776

Rabbit Polyclonal Anti-OPN1SW Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-OPN1SW antibody: synthetic peptide directed towards the C terminal of human OPN1SW. Synthetic peptide located within the following region: SESYTWFLFIFCFIVPLSLICFSYTQLLRALKAVAAQQQESATTQKAERE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 39 kDa
• Gene Name: opsin 1 (cone pigments), short-wave-sensitive
• Database Link:
  NP_001699
  P03999
• Background: This gene belongs to the G-protein coupled receptor 1 family, opsin subfamily. It encodes the blue cone pigment gene which is one of three types of cone photoreceptors responsible for normal color vision. Defects in this gene are the cause of tritan color blindness (tritanopia). Affected individuals lack blue and yellow sensory mechanisms while retaining those for red and green. Defective blue vision is characteristic.
• Synonyms: BCP; BOP; CBT
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%

Reference Data

• Protein Families: Druggable Genome, Transmembrane