GRK7 Rabbit Polyclonal Antibody

SKU TA342751

Rabbit Polyclonal Anti-GRK7 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GRK7 antibody: synthetic peptide directed towards the C terminal of human GRK7. Synthetic peptide located within the following region: FFKNFATGAVPIAWQEEIIETGLFEELNDPNRPTGCEEGNSSKSGVCLLL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 62 kDa
• Gene Name: G protein-coupled receptor kinase 7
• Database Link:
  NP_631948
  Q8WTQ7
• Background: This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. It is specifically expressed in the retina and the encoded protein has been shown to phosphorylate cone opsins and initiate their deactivation.
• Synonyms: GPRK7
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 92%; Pig: 91%; Guinea pig: 91%; Bovine: 85%; Rat: 82%; Horse: 79%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Chemokine signaling pathway, Endocytosis