Fascin 2 (FSCN2) Rabbit Polyclonal Antibody

SKU TA342740

Rabbit Polyclonal Anti-FSCN2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FSCN2 antibody: synthetic peptide directed towards the middle region of human FSCN2. Synthetic peptide located within the following region: AGTLKAGRNTRPGKDELFDLEESHPQVVLVAANHRYVSVRQGVNVSANQD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 57 kDa
• Gene Name: fascin actin-bundling protein 2, retinal
• Database Link:
  NP_001070650
  O14926
• Background: This gene encodes a member of the fascin protein family. Fascins crosslink actin into filamentous bundles within dynamic cell extensions. This family member is proposed to play a role in photoreceptor disk morphogenesis. A mutation in this gene results in one form of autosomal dominant retinitis pigmentosa and macular degeneration. Multiple transcript variants encoding different isoforms have been found for this gene.
• Synonyms: RFSN; RP30
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 86%; Zebrafish: 86%

Reference Data