USP6 Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-USP6 antibody is: synthetic peptide directed towards the C-terminal region of Human USP6. Synthetic peptide located within the following region: NHSEEDSTDDQREDTHIKPIYNLYAISCHSGILSGGHYITYAKNPNCKWY |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 119 kDa |
Gene Name | ubiquitin specific peptidase 6 |
Database Link | |
Background | USP6 is a deubiquitinase with an ATP-independent isopeptidase activity, cleaving at the C-terminus of the ubiquitin moiety. It catalyzes its own deubiquitination. In vitro, isoform 2, but not isoform 3, shows deubiquitinating activity. USP6 promotes plasma membrane localization of ARF6 and selectively regulates ARF6-dependent endocytic protein trafficking. It is able to initiate tumorigenesis by inducing the production of matrix metalloproteinases following NF-kappa-B activation. |
Synonyms | HRP1; Tre-2; TRE2; TRE17; TRESMCR; USP6-short |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 91% |
Reference Data | |
Protein Families | Druggable Genome, Protease |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.