USP1 Rabbit Polyclonal Antibody

CAT#: TA342565

Rabbit Polyclonal Anti-USP1 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of ubiquitin specific peptidase 1 (USP1), transcript variant 1
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human ubiquitin specific peptidase 1 (USP1), transcript variant 3, 20 µg
    • 20 ug

USD 867.00

Other products for "USP1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-USP1 antibody: synthetic peptide directed towards the C terminal of human USP1. Synthetic peptide located within the following region: SETSDTTGTHESDRNKESSDQTGINISGFENKISYVVQSLKEYEGKWLLF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 88 kDa
Gene Name ubiquitin specific peptidase 1
Background This gene encodes a member of the ubiquitin-specific processing (UBP) family of proteases that is a deubiquitinating enzyme (DUB) with His and Cys domains. This protein is located in the cytoplasm and cleaves the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. The protein specifically deubiquitinates a protein in the Fanconi anemia (FA) DNA repair pathway. Alternate transcriptional splice variants have been characterized.
Synonyms UBP
Note Immunogen Sequence Homology: Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 92%; Bovine: 92%; Dog: 86%; Guinea pig: 86%
Reference Data
Protein Families Protease

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.