USP1 Rabbit Polyclonal Antibody

SKU
TA342565
Rabbit Polyclonal Anti-USP1 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-USP1 antibody: synthetic peptide directed towards the C terminal of human USP1. Synthetic peptide located within the following region: SETSDTTGTHESDRNKESSDQTGINISGFENKISYVVQSLKEYEGKWLLF
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 88 kDa
Gene Name ubiquitin specific peptidase 1
Database Link
Background This gene encodes a member of the ubiquitin-specific processing (UBP) family of proteases that is a deubiquitinating enzyme (DUB) with His and Cys domains. This protein is located in the cytoplasm and cleaves the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. The protein specifically deubiquitinates a protein in the Fanconi anemia (FA) DNA repair pathway. Alternate transcriptional splice variants have been characterized.
Synonyms UBP
Note Immunogen Sequence Homology: Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 92%; Bovine: 92%; Dog: 86%; Guinea pig: 86%
Reference Data
Protein Families Protease
Write Your Own Review
You're reviewing:USP1 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.