GPR27 Rabbit Polyclonal Antibody

SKU TA342544

Rabbit Polyclonal Anti-GPR27 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GPR27 antibody: synthetic peptide directed towards the middle region of human GPR27. Synthetic peptide located within the following region: AVTLLFLLLWGPYVVASYLRVLVRPGAVPQAYLTASVWLTFAQAGINPVV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 40 kDa
• Gene Name: G protein-coupled receptor 27
• Database Link:
  NP_061844
  Q9NS67
• Background: GPR27 is a member of the G protein-coupled receptors (GPCRs), a large family of receptors that have a similar structure characterized by 7 transmembrane domains. Activation of GPCRs by extracellular stimuli such as neurotransmitters, hormones, or light induces an intracellular signaling cascade mediated by heterotrimeric GTP-binding proteins, or G proteins. [supplied by OMIM, May 2010]. ##Evidence-Data-START## Transcript exon combination :: AB040799.1 [ECO:0000332] ##Evidence-Data-END##
• Synonyms: SREB1
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane