Growth Arrest Specific Protein 7 (GAS7) Rabbit Polyclonal Antibody

SKU TA342513

Rabbit Polyclonal Anti-GAS7 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GAS7 antibody: synthetic peptide directed towards the N terminal of human GAS7. Synthetic peptide located within the following region: SGARCRTLYPFSGERHGQGLRFAAGELITLLQVPDGGWWEGEKEDGLRGW
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 54 kDa
• Gene Name: growth arrest specific 7
• Database Link:
  NP_958839
  O60861
• Background: Growth arrest-specific 7 is expressed primarily in terminally differentiated brain cells and predominantly in mature cerebellar Purkinje neurons. GAS7 plays a putative role in neuronal development. Several transcript variants encoding proteins which vary in the N-terminus have been described. [provided by RefSeq, Jul 2008]
• Synonyms: GAS7; MLL
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%

Reference Data

• Protein Families: Transcription Factors