C3ORF31 (TAMM41) Rabbit Polyclonal Antibody

SKU TA342495

Rabbit Polyclonal Anti-C3orf31 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C3orf31 antibody: synthetic peptide directed towards the N terminal of human C3orf31. Synthetic peptide located within the following region: QSSWVTFRKILSHFPEELSLAFVYGSGVYRQAGPSSDQKNAMLDFVFTVD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 36 kDa
• Gene Name: TAM41 mitochondrial translocator assembly and maintenance homolog
• Database Link:
  NP_620162
  Q96BW9
• Background: May be involved in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
• Synonyms: C3orf31; RAM41; TAM41
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Guinea pig: 93%; Horse: 92%; Dog: 86%; Rabbit: 86%; Mouse: 77%

Reference Data

• Protein Families: Transcription Factors