C3ORF31 (TAMM41) Rabbit Polyclonal Antibody

SKU TA342494

Rabbit Polyclonal Anti-TAMM41 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TAMM41 antibody is: synthetic peptide directed towards the C-terminal region of Human TAMM41. Synthetic peptide located within the following region: VVGEDKTKVLNIVKPNIAHFRELYGSILQENPQVVYKSQQGWLEIDKSPE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 34 kDa
• Gene Name: TAM41 mitochondrial translocator assembly and maintenance homolog
• Database Link:
  NP_620162
  Q96BW9
• Background: May be involved in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
• Synonyms: C3orf31; RAM41; TAM41
• Note: Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 93%; Guinea pig: 93%; Dog: 86%; Rat: 86%; Rabbit: 86%; Mouse: 79%

Reference Data

• Protein Families: Transcription Factors