OriGene Logo

C3ORF31 (TAMM41) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA342494
Rabbit Polyclonal Anti-TAMM41 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $575.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY408493 Transient overexpression lysate of chromosome 3 open reading frame 31 (C3orf31) 100 ug
$436.00

View other "C3ORF31 or NM_138807" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TAMM41 antibody is: synthetic peptide directed towards the C-terminal region of Human TAMM41. Synthetic peptide located within the following region: VVGEDKTKVLNIVKPNIAHFRELYGSILQENPQVVYKSQQGWLEIDKSPE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 34 kDa
Gene Name TAM41 mitochondrial translocator assembly and maintenance homolog
Database Link
Background May be involved in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Synonyms C3orf31; RAM41; TAM41
Note Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 93%; Guinea pig: 93%; Dog: 86%; Rat: 86%; Rabbit: 86%; Mouse: 79%
Reference Data
Protein Categories Intracellular Proteins
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.