Exportin 5 (XPO5) Rabbit Polyclonal Antibody

SKU TA342468

Rabbit Polyclonal Anti-XPO5 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-XPO5 antibody: synthetic peptide directed towards the middle region of human XPO5. Synthetic peptide located within the following region: MEQIPEIQKDSLDQFDCKLLNPSLQKVADKRRKDQFKRLIAGCIGKPLGE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 136 kDa
• Gene Name: exportin 5
• Database Link:
  NP_065801
  Q9HAV4
• Background: This gene encodes a member of the karyopherin family that is required for the transport of small RNAs and double-stranded RNA-binding proteins from the nucleus to the cytoplasm. The encoded protein translocates cargo through the nuclear pore complex in a RanGTP-dependent process. [provided by RefSeq, Aug 2011]
• Synonyms: exp5
• Note: Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 93%; Rat: 86%; Mouse: 86%

Reference Data

• Protein Families: Druggable Genome