MAML3 Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MAML3 antibody: synthetic peptide directed towards the middle region of human MAML3. Synthetic peptide located within the following region: YPVQQVNQFQGSPQDIAAVRSQAALQSMRTSRLMAQNAGMMGIGPSQNPG |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 122 kDa |
Gene Name | mastermind like transcriptional coactivator 3 |
Database Link | |
Background | MAML3 acts as a transcriptional coactivator for NOTCH proteins. MAML3 has been shown to amplify NOTCH-induced transcription of HES1. |
Synonyms | CAGH3; ERDA3; GDN; MAM-2; MAM2; TNRC3 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93% |
Reference Data | |
Protein Families | Transcription Factors |
Protein Pathways | Notch signaling pathway |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.