PAXBP1 Rabbit Polyclonal Antibody

SKU
TA342457
Rabbit Polyclonal Anti-C21orf66 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-C21orf66 antibody: synthetic peptide directed towards the N terminal of human C21orf66. Synthetic peptide located within the following region: PGEIPDAAFIHAARKKRQMARELGDFTPHDNEPGKGRLVREDENDASDDE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 93 kDa
Gene Name PAX3 and PAX7 binding protein 1
Database Link
Background This gene encodes a protein that may bind to GC-rich DNA sequences, which suggests its involvement in the regulation of transcription. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jun 2009]
Synonyms BM020; C21orf66; FSAP105; GCFC; GCFC1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:PAXBP1 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.