ZNF131 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-ZNF131 antibody: synthetic peptide directed towards the N terminal of human ZNF131. Synthetic peptide located within the following region: EFLQMLEAIKALEVRNKENSAPLEENTTGKNEAKKRKIAETSNVITESLP |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 67 kDa |
| Gene Name | zinc finger protein 131 |
| Database Link | |
| Background | ZNF131 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 1 BTB (POZ) domain and 6 C2H2-type zinc fingers. It may be involved in transcriptional regulation. ZNF131 plays a role during development and organogenesis as well as in the function of the adult central nervous system. |
| Synonyms | pHZ-10; ZBTB35 |
| Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Bovine: 93%; Rabbit: 93%; Horse: 86% |
| Reference Data | |
| Protein Categories | Intracellular Proteins, Transciption Factors |
| Protein Families | Transcription Factors |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.