ARGFX Rabbit Polyclonal Antibody

SKU TA342402

Rabbit Polyclonal Anti-ARGFX Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ARGFX antibody: synthetic peptide directed towards the N terminal of human ARGFX. Synthetic peptide located within the following region: TTAIRRRHKERTSFTHQQYEELEALFSQTMFPDRNLQEKLALRLDLPEST
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 35 kDa
• Gene Name: arginine-fifty homeobox
• Database Link:
  NP_001012677
  A6NJG6
• Background: Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. This gene is a member of the ARGFX homeobox gene family. [provided by RefSeq, Jul 2008]
• Synonyms: ARGFX
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 91%; Bovine: 90%

Reference Data

• Protein Families: Transcription Factors