OriGene Logo

ARGFX Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA342402
Rabbit Polyclonal Anti-ARGFX Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY422893 Transient overexpression lysate of arginine-fifty homeobox (ARGFX) 100 ug
$436.00

View other "ARGFX or NM_001012659" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ARGFX antibody: synthetic peptide directed towards the N terminal of human ARGFX. Synthetic peptide located within the following region: TTAIRRRHKERTSFTHQQYEELEALFSQTMFPDRNLQEKLALRLDLPEST
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 35 kDa
Gene Name arginine-fifty homeobox
Database Link
Background Homeobox genes encode DNA-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a DNA-binding domain of 60 to 63 amino acids referred to as the homeodomain. This gene is a member of the ARGFX homeobox gene family. provided by RefSeq, Jul 2008
Synonyms ARGFX
Note Immunogen Sequence Homology: Human: 100%; Pig: 91%; Bovine: 90%
Reference Data
Protein Categories Intracellular Proteins, Transciption Factors
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.