CARKD (NAXD) Rabbit Polyclonal Antibody

SKU TA342363

Rabbit Polyclonal Anti-FLJ10769 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FLJ10769 antibody: synthetic peptide directed towards the middle region of human FLJ10769. Synthetic peptide located within the following region: ILSNGQQVLVCSQEGSSRRCGGQGDLLSGSLGVLVHWALLAGPQKTNGGI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 41 kDa
• Gene Name: NAD(P)HX dehydratase
• Database Link:
  NP_060680
  Q8IW45
• Background: The exact function of FLJ10769 remains unknown.
• Synonyms: CARKD; LP3298
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Dog: 93%; Guinea pig: 86%; Yeast: 85%

Reference Data

• Protein Families: Transmembrane