OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HHAT Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA342360
Rabbit Polyclonal Anti-HHAT Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
TP308447 Recombinant protein of human hedgehog acyltransferase (HHAT), transcript variant 1, 20 µg
20 ug
$867.00

View other "HHAT or NM_018194" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-HHAT antibody: synthetic peptide directed towards the N terminal of human HHAT. Synthetic peptide located within the following region: MLPRWELALYLLASLGFHFYSFYEVYKVSREHEEELDQEFELETDTLFGG
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 57 kDa
Gene Name hedgehog acyltransferase
Database Link
Background 'Skinny hedgehog' (SKI1) encodes an enzyme that acts within the secretory pathway to catalyze amino-terminal palmitoylation of 'hedgehog' (see MIM 600725). supplied by OMIM, Jul 2002. Transcript Variant: This variant (4) lacks an in-frame exon in the coding region compared to variant 1. The encoded isoform (3) is shorter than isoform 1. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. ##Evidence-Data-START## Transcript exon combination :: AK298991.1 ECO:0000332 RNAseq introns :: single sample supports all introns ERS025090 ECO:0000348 ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
Synonyms MART2; SKI1; Skn
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 79%
Reference Data
Protein Categories Intracellular Proteins, Membrane Proteins
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products