TMEM16K (ANO10) Rabbit Polyclonal Antibody

SKU TA342353

Rabbit Polyclonal Anti-TMEM16K Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMEM16K antibody: synthetic peptide directed towards the C terminal of human TMEM16K. Synthetic peptide located within the following region: LKADIDATLYEQVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 76 kDa
• Gene Name: anoctamin 10
• Database Link:
  NP_060545
  Q9NW15
• Background: The transmembrane protein encoded by this gene is a member of a family of calcium-activated chloride channels. Defects in this gene may be a cause of autosomal recessive spinocerebellar ataxia-10. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2011]
• Synonyms: SCAR10; TMEM16K
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%

Reference Data

• Protein Families: Transmembrane