Ecsit Rabbit Polyclonal Antibody

SKU TA342302

Rabbit Polyclonal Anti-Ecsit Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Ecsit antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EPWLVPRPPEPQRKPIKVPAMHEDSFKPSGNRERDKASFLNAVRSFGAHN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 50 kDa
• Gene Name: ECSIT signalling integrator
• Database Link:
  NP_036159
  Q9QZH6
• Background: Ecsit is required for efficient assembly of mitochondrial NADH:ubiquinone oxidoreductase. Ecsit is an adapter protein of the Toll-like and IL-1 receptor signaling pathway that is involved in the activation of NF-kappa-B via MAP3K1.Ecsit promotes proteolytic activation of MAP3K1. Ecsit is involved in the BMP signaling pathway. Ecsit is required for normal embryonic development.
• Synonyms: SITPEC
• Note: Immunogen Sequence Homology: Mouse: 100%

Reference Data