TCEA1 Rabbit Polyclonal Antibody

SKU TA342295

Rabbit Polyclonal Anti-Tcea1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Tcea1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NALRKQSTDEEVTSLAKSLIKSWKKLLDGPSTDKDPEEKKKEPAISSQNS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 34 kDa
• Gene Name: transcription elongation factor A1
• Database Link:
  NP_958845
  P23193
• Background: Necessary for efficient RNA polymerase II transcription elongation past template-encoded arresting sites. The arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage of the nascent transcript by S-II allows the resumption of elongation from the new 3'-terminus.
• Synonyms: GTF2S; SII; TCEA; TF2S; TFIIS
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Rabbit: 93%; Dog: 79%; Pig: 79%; Horse: 79%; Human: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Transcription Factors