Srebf1 Rabbit Polyclonal Antibody

SKU TA342292

Rabbit Polyclonal Anti-SREBF1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SREBF1 antibody: synthetic peptide directed towards the N terminal of mouse SREBF1. Synthetic peptide located within the following region: DIEDMLQLINNQDSDFPGLFDAPYAGGETGDTGPSSPGANSPESFSSASL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 125 kDa
• Gene Name: sterol regulatory element binding transcription factor 1
• Database Link:
  NP_035610
  Q9WTN3
• Background: Srebf1 is transcriptional activator that binds to the sterol regulatory element 1 (SRE-1) (5'-ATCACCCCAC-3'). Srebf1 also binds to an E-box motif (5'-ATCACGTGA-3'). Srebf1 regulates the transcription of genes for sterol biosynthesis and the LDL receptor gene.
• Synonyms: bHLHd1; SREBP-1; SREBP-1c; SREBP1
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 93%

Reference Data