SAM68 (KHDRBS1) Rabbit Polyclonal Antibody

SKU TA342288

Rabbit Polyclonal Anti-KHDRBS1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KHDRBS1 antibody: synthetic peptide directed towards the N terminal of mouse KHDRBS1. Synthetic peptide located within the following region: MQRRDDPASRLTRSSGRSCSKDPSGAHPSVRLTPSRPSPLPHRPRGGGGG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 49 kDa
• Gene Name: KH RNA binding domain containing, signal transduction associated 1
• Database Link:
  NP_006550
  Q07666
• Background: Khdrbs1 functions as a transcriptional repressor and may link cellular signaling pathways with components of the transcriptional machinery. It shuttles between the nucleus and the cytoplasm in secondary spermatocytes, suggesting that it may promote translation of specific RNA targets during the meiotic divisions.
• Synonyms: p62; p68; Sam68
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Mouse: 100%; Pig: 92%; Bovine: 92%; Human: 86%; Rabbit: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Transcription Factors