MYBPH Rabbit Polyclonal Antibody

SKU TA342225

Rabbit polyclonal Anti-MYBPH Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MYBPH antibody: synthetic peptide directed towards the N terminal of human MYBPH. Synthetic peptide located within the following region: LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 52 kDa
• Gene Name: myosin binding protein H
• Database Link:
  NP_004988
  Q13203
• Background: Binds to myosin; probably involved in interaction with thick myofilaments inThe A-band.
• Synonyms: myosin-binding protein H; myosin binding protein H; OTTHUMP00000039086
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Horse: 93%; Bovine: 86%; Guinea pig: 86%

Reference Data