Semaphorin 3F (SEMA3F) Rabbit Polyclonal Antibody

SKU TA342215

Rabbit polyclonal Anti-Sema3f Antibody

Product Data

• Application: IHC, IP, WB
• Recommended Dilution: IP, IHC, WB
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Sema3f antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FIHAELIPDSAERNDDKLYFFFRERSAEAPQNPAVYARIGRICLNDDGGH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 83 kDa
• Gene Name: semaphorin 3F
• Database Link:
  NP_004177
  Q13275
• Background: The function remains unknown.
• Synonyms: SEMA-IV; SEMA4; SEMAK
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Zebrafish: 91%

Reference Data

• Protein Families: Secreted Protein
• Protein Pathways: Axon guidance