Rab5 (RAB5A) Rabbit Polyclonal Antibody

SKU TA342212

Rabbit polyclonal Anti-RAB5A Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human, Mouse, Zebrafish
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RAB5A antibody: synthetic peptide directed towards the middle region of human RAB5A. Synthetic peptide located within the following region: KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 24 kDa
• Gene Name: RAB5A, member RAS oncogene family
• Database Link:
  NP_004153
  P20339
• Background: RAB5A is required forThe fusion of plasma membranes and early endosomes.
• Synonyms: RAB5
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%; Rabbit: 93%; Sheep: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Amyotrophic lateral sclerosis (ALS), Endocytosis