RFC1 Rabbit Polyclonal Antibody

SKU TA342194

Rabbit polyclonal Anti-Rfc1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Rat
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Rfc1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Rfc1. Synthetic peptide located within the following region: SPTKRESVSPEDSEKKRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 72 kDa
• Gene Name: replication factor C subunit 1
• Database Link:
  NP_002904
  P35251
• Background: transcriptional repressor that regulates transcription ofThe vasoactive intestinal peptide receptor gene [RGD, Feb 2006]. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns ERS160522, ERS240727 [ECO:0000348] ##Evidence-Data-END##
• Synonyms: A1; MHCBFB; PO-GA; RECC1; RFC; RFC140
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: DNA replication, Mismatch repair, Nucleotide excision repair