OriGene Logo

RFC1 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA342194
Rabbit polyclonal Anti-Rfc1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (1)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00

View other "RFC1 or NM_002913" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Rat
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Rfc1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Rfc1. Synthetic peptide located within the following region: SPTKRESVSPEDSEKKRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEG
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 72 kDa
Gene Name replication factor C subunit 1
Database Link
Background transcriptional repressor that regulates transcription ofThe vasoactive intestinal peptide receptor gene RGD, Feb 2006. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns ERS160522, ERS240727 ECO:0000348 ##Evidence-Data-END##
Synonyms A1; MHCBFB; PO-GA; RECC1; RFC; RFC140
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%
Reference Data
Protein Categories Intracellular Proteins, Nervous system Diseases
Protein Families Transcription Factors
Protein Pathways DNA replication, Mismatch repair, Nucleotide excision repair
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.