RASGRF1 Rabbit Polyclonal Antibody

SKU TA342190

Rabbit polyclonal Anti-RASGRF1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RASGRF1 antibody: synthetic peptide directed towards the N terminal of human RASGRF1. Synthetic peptide located within the following region: RELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 54 kDa
• Gene Name: Ras protein specific guanine nucleotide releasing factor 1
• Database Link:
  NP_722522
  Q13972
• Background: The protein encoded byThis gene is a guanine nucleotide exchange factor (GEF) similar toThe Saccharomyces cerevisiae CDC25 gene product. Functional analysis has demonstrated thatThis protein stimulatesThe dissociation of GDP from RAS protein.The studies ofThe similar gene in mouse suggested thatThe Ras-GEF activity ofThis protein in brain can be activated by Ca2+ influx, muscarinic receptors, and G protein beta-gamma subunit. Mouse studies also indicated thatThe Ras-GEF signaling pathway mediated byThis protein may be important for long-term memory. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Mar 2009]
• Synonyms: CDC25; CDC25L; GNRP; GRF1; GRF55; H-GRF55; PP13187; ras-GRF1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 93%; Rabbit: 93%; Zebrafish: 93%; Mouse: 85%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Focal adhesion, MAPK signaling pathway