Trypsin (PRSS3) Rabbit Polyclonal Antibody

SKU TA342157

Rabbit polyclonal Anti-PRSS3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PRSS3 antibody: synthetic peptide directed towards the N terminal of human PRSS3. Synthetic peptide located within the following region: VAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 33 kDa
• Gene Name: protease, serine 3
• Database Link:
  NP_031369
  P35030
• Background: This gene encodes a trypsinogen, which is a member ofThe trypsin family of serine proteases.This enzyme is expressed inThe brain and pancreas and is resistant to common trypsin inhibitors. It is active on peptide linkages involvingThe carboxyl group of lysine or arginine.This gene is localized toThe locus of T cell receptor beta variable orphans on chromosome 9. Four transcript variants encoding different isoforms have been described forThis gene. [provided by RefSeq, Oct 2010]
• Synonyms: MTG; PRSS4; T9; TRY3; TRY4
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Dog: 92%; Horse: 92%; Mouse: 92%; Rabbit: 92%; Bovine: 91%

Reference Data

• Protein Families: Druggable Genome, Protease, Secreted Protein
• Protein Pathways: Neuroactive ligand-receptor interaction