PKC iota (PRKCI) Rabbit Polyclonal Antibody

SKU TA342150

Rabbit polyclonal Anti-PRKCI Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PRKCI antibody: synthetic peptide directed towards the middle region of human PRKCI. Synthetic peptide located within the following region: TVIPYNPSSHESLDQVGEEKEAMNTRESGKASSSLGLQDFDLLRVIGRGS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 68 kDa
• Gene Name: protein kinase C iota
• Database Link:
  NP_002731
  P41743
• Background: This gene encodes a member ofThe protein kinase C (PKC) family of serine/threonine protein kinases.The PKC family comprises at least eight members, which are differentially expressed and are involved in a wide variety of cellular processes.This protein kinase is calcium-independent and phospholipid-dependent. It is not activated by phorbolesters or diacylglycerol.This kinase can be recruited to vesicle tubular clusters (VTCs) by direct interaction withThe small GTPase RAB2, whereThis kinase phosphorylates glyceraldehyde-3-phosphate dehydrogenase (GAPD/GAPDH) and plays a role in microtubule dynamics inThe early secretory pathway.This kinase is found to be necessary for BCL-ABL-mediated resistance to drug-induced apoptosis andTherefore protects leukemia cells against drug-induced apoptosis.There is a single exon pseudogene mapped on chromosome X. [provided by RefSeq, Jul 2008]
• Synonyms: DXS1179E; nPKC-iota; PKCI
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Endocytosis, Insulin signaling pathway, Tight junction