TCEAL4 Rabbit Polyclonal Antibody

SKU TA342116

Rabbit Polyclonal Anti-TCEAL4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TCEAL4 antibody: synthetic peptide directed towards the middle region of human TCEAL4. Synthetic peptide located within the following region: GSETRAAGKRPAEDDVPRKAKRKTNKGLAHYLKEYKEAIHDMNFSNEDMI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 25 kDa
• Gene Name: transcription elongation factor A like 4
• Database Link:
  NP_001006938
  Q96EI5
• Background: TCEAL4 is a member ofThe transcription elongation factor A (SII)-like (TCEAL) gene family. Members ofThis family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located onThe X chromosome.This gene encodes a member ofThe transcription elongation factor A (SII)-like (TCEAL) gene family. Members ofThis family contain TFA domains and may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located onThe X chromosome. Alternative splicing occurs forThis gene; however,The full-length nature of all transcript variants has not yet been described.
• Synonyms: NPD017; WEX7
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Rabbit: 100%; Pig: 92%; Bovine: 92%; Rat: 90%; Dog: 85%; Mouse: 85%; Guinea pig: 85%

Reference Data