Diffuse panbronchiolitis critical region protein 1 (DPCR1) Rabbit Polyclonal Antibody

CAT#: TA342095

Rabbit Polyclonal Anti-DPCR1 Antibody

Product Images

WB Suggested Anti-DPCR1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DPCR1 antibody: synthetic peptide directed towards the C terminal of human DPCR1. Synthetic peptide located within the following region: SHLNKTEVTHQVPTGSFTLITSRTKLSSITSEATGNESHPYLNKDGSQKG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: diffuse panbronchiolitis critical region 1
• Database Link:
  NP_543146
  Entrez Gene 135656 Human
  UniProt ID Q3MIW9
• Background: The exact function of DPCR1 remains unknown.
• Synonyms: PBLT
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transmembrane