TMC2 Rabbit Polyclonal Antibody

SKU
TA342093
Rabbit Polyclonal Anti-TMC2 Antibody
  $585.00
5 Days*
Bulk/Customize
Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TMC2 antibody: synthetic peptide directed towards the middle region of human TMC2. Synthetic peptide located within the following region: YCWCWDLEAGFPSYAEFDISGNVLGLIFNQGMIWMGSFYAPGLVGINVLR
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 102 kDa
Gene Name transmembrane channel like 2
Database Link
Background TMC2 is considered a member of transmembrane proteins family.The specific function ofThis gene is unknown; however, expression inThe inner ear suggests that it may be crucial for normal auditory function.This gene is considered a member of a gene family predicted to encode transmembrane proteins.The specific function ofThis gene is unknown; however, expression inThe inner ear suggests that it may be crucial for normal auditory function. Mutations inThis gene may underlie hereditary disorders of balance and hearing. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-382 AF417580.2 1-382 383-569 DA769512.1 96-282 570-859 DA769512.1 286-575 860-2736 AF417580.2 860-2736 2737-3169 AL049712.12 30165-30597 c
Synonyms C20orf145
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Rabbit: 85%
Reference Data
Protein Categories Membrane Proteins
Protein Families Transmembrane
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.