Aquaporin 10 (AQP10) Rabbit Polyclonal Antibody

SKU TA342084

Rabbit Polyclonal Anti-AQP10 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AQP10 antibody: synthetic peptide directed towards the C terminal of human AQP10. Synthetic peptide located within the following region: VGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 32 kDa
• Gene Name: aquaporin 10
• Database Link:
  NP_536354
  Q96PS8
• Background: AQP10 is a member ofThe aquaglyceroporin family of integral membrane proteins. Members ofThis family function as water-permeable channels inThe epithelia of organs that absorb and excrete water. AQP10 was shown to function as a water-selective channel, and could also permeate neutral solutes such as glycerol and urea.This gene encodes a member ofThe aquaglyceroporin family of integral membrane proteins. Members ofThis family function as water-permeable channels inThe epithelia of organs that absorb and excrete water.This protein was shown to function as a water-selective channel, and could also permeate neutral solutes such as glycerol and urea.
• Synonyms: AQPA_HUMAN
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 79%; Bovine: 75%; Rabbit: 75%

Reference Data

• Protein Families: Transmembrane