LRRC62 (ELFN2) Rabbit Polyclonal Antibody

SKU TA342068

Rabbit Polyclonal Anti-ELFN2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ELFN2 antibody: synthetic peptide directed towards the N terminal of human ELFN2. Synthetic peptide located within the following region: PVSHPTPYSTDAQREPDENSGFNPDEILSVEPPASSTTDASAGPAIKLHH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 90 kDa
• Gene Name: extracellular leucine-rich repeat and fibronectin type III domain containing 2
• Database Link:
  NP_443138
  Q5R3F8
• Background: ELFN2 is a single-pass membrane protein. It contains 1 fibronectin type-III domain and 5 LRR (leucine-rich) repeats.The exact function of ELFN2 remains unknown.
• Synonyms: LRRC62; PPP1R29
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%

Reference Data

• Protein Families: Transmembrane