CNTNAP3 Rabbit Polyclonal Antibody

SKU
TA342063
Rabbit Polyclonal Anti-CNTNAP3 Antibody
  $585.00
5 Days*
Bulk/Customize
Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CNTNAP3 antibody: synthetic peptide directed towards the middle region of human CNTNAP3. Synthetic peptide located within the following region: GSGPLGPFLVYCNMTADAAWTVVQHGGPDAVTLRGAPSGHPRSAVSFAYA
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 141 kDa
Gene Name contactin associated protein-like 3
Database Link
Background The specific function ofThis protein remains unknown.The protein encoded byThis gene belongs toThe NCP family of cell-recognition molecules.This family represents a distinct subgroup ofThe neurexins. NCP proteins mediate neuron-glial interactions in vertebrates and glial-glial contact in invertebrates.The protein encoded byThis gene may play a role in cell recognition withinThe nervous system. Alternatively spliced transcript variants encoding different isoforms have been described butTheir biological nature has not been determined.
Synonyms CASPR3; CNTNAP3A
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Categories Intracellular Proteins, Membrane Proteins
Protein Families Secreted Protein, Transmembrane
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.