OriGene Logo

HLA DP (HLA-DPA1) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA342062
Rabbit Polyclonal Anti-HLA-DPA1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY403253 Transient overexpression lysate of major histocompatibility complex, class II, DP alpha 1 (HLA-DPA1) 100 ug
$436.00

View other "HLA DP or NM_033554" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-HLA-DPA1 antibody: synthetic peptide directed towards the middle region of human HLA-DPA1. Synthetic peptide located within the following region: EAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGT
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 26 kDa
Gene Name major histocompatibility complex, class II, DP alpha 1
Database Link
Background The specific function ofThis protein remains unknown.HLA-DPA1 belongs toThe HLA class II alpha chain paralogues.This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta (DPB) chain, both anchored inThe membrane. It plays a central role inThe immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages).The alpha chain is approximately 33-35 kDa and its gene contains 5 exons. Exon one encodesThe leader peptide, exons 2 and 3 encodeThe two extracellular domains, exon 4 encodesThe transmembrane domain andThe cytoplasmic tail. WithinThe DP molecule bothThe alpha chain andThe beta chain containThe polymorphisms specifyingThe peptide binding specificities, resulting in up to 4 different molecules. Publication Note:This RefSeq record includes a subset ofThe publications that are available forThis gene. Please seeThe Entrez Gene record to access additional publications.
Synonyms DP(W3); DP(W4); HLA-DP1A; HLADP; HLASB; PLT1
Note Immunogen Sequence Homology: Human: 100%; Pig: 86%
Reference Data
Protein Categories Allergies and autoimmune diseases, Cardiovascular diseases, Intracellular Proteins, Membrane Proteins
Protein Families Transmembrane
Protein Pathways Allograft rejection, Antigen processing and presentation, Asthma, Autoimmune thyroid disease, Cell adhesion molecules (CAMs), Graft-versus-host disease, Systemic lupus erythematosus, Type I diabetes mellitus, Viral myocarditis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.