MMEL1 Rabbit Polyclonal Antibody

SKU
TA342060
Rabbit Polyclonal Anti-MMEL1 Antibody
  $585.00
5 Days*
Bulk/Customize
Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MMEL1 antibody: synthetic peptide directed towards the middle region of human MMEL1. Synthetic peptide located within the following region: EVVVYGIPYLQNLENIIDTYSARTIQNYLVWRLVLDRIGSLSQRFKDTRV
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 88 kDa
Gene Name membrane metallo-endopeptidase-like 1
Database Link
Background MMEL1 is a member ofThe neutral endopeptidase (NEP) or membrane metallo-endopeptidase (MME) family. Family members play important roles in pain perception, arterial pressure regulation, phosphate metabolism and homeostasis. MMEL1 is a type II transmembrane protein and is thought to be expressed as a secreted protein.The protein encoded byThis gene is a member ofThe neutral endopeptidase (NEP) or membrane metallo-endopeptidase (MME) family. Family members play important roles in pain perception, arterial pressure regulation, phosphate metabolism and homeostasis.This protein is a type II transmembrane protein and is thought to be expressed as a secreted protein.This gene is expressed mainly in testis with weak expression inThe brain, kidney, and heart.
Synonyms MMEL2; NEP2; NEPII; NL1; NL2; SEP
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%
Reference Data
Protein Categories Enzyme: Peptidases, Intracellular Proteins
Protein Families Druggable Genome, Protease, Secreted Protein, Transmembrane
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.