OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PGAP3 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA342058
Rabbit Polyclonal Anti-PGAP3 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY409544 Transient overexpression lysate of post-GPI attachment to proteins 3 (PGAP3) (as WB positive control) 100 ug
$436.00

View other "PGAP3 or NM_033419" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PGAP3 antibody: synthetic peptide directed towards the N terminal of human PGAP3. Synthetic peptide located within the following region: AGLAARLVLLAGAAALASGSQGDREPVYRDCVLQCEEQNCSGGALNHFRS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 36 kDa
Gene Name post-GPI attachment to proteins 3
Database Link
Background PGAP3 is involved inThe lipid remodeling steps of GPI-anchor maturation. Lipid remodeling steps consist inThe generation of 2 saturated fatty chains atThe sn-2 position of GPI-anchors proteins. It is required for phospholipase A2 activity that removes an acyl-chain atThe sn-2 position of GPI-anchors duringThe remodeling of GPI.
Synonyms AGLA546; CAB2; hCOS16; PERLD1; PP1498
Note Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Mouse: 93%; Guinea pig: 93%; Rat: 86%; Zebrafish: 85%
Reference Data
Protein Categories Intracellular Proteins, Membrane Proteins
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

PGAP3 Associated with Hyperphosphatasia with Mental Retardation Plays a Novel Role in Brain Morphogenesis and Neuronal Wiring at Early Development
Da'as, Aamer, Hasan et al
Cells (2020) 9 (8) DOI: 10.3390/cells9081782
Cited by 29
AI Summary: OriGene’s polyclonal anti-PGAP3 antibody (TA342058) was used in this study to detect and analyze PGAP3 protein expression in zebrafish embryos, enabling the authors to assess the effects of PGAP3 loss on brain development and neuronal wiring.
Snippet: Total protein was extracted from embryos of the control or pgap3 MO-injected groups (~30 embryos per group) at 72 hpf using an RIPA lysis buffer (Thermo-scientific, 89900) containing phosphatase inhibitor cocktail and halt protease. …After electrophoresis, the gel was transferred into a nitrocellulose membrane and incubated with polyclonal anti-PGAP3 antibody (Origene, TA342058), (1:300 dilution) overnight at 4 ◦C, followed by incubation with rabbit anti-human α-tubulin antibody (Abcam, ab4074), (1:1000 dilution) for 1 h at room temperature. …
WB
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products