C17orf80 Rabbit Polyclonal Antibody

SKU TA342049

Rabbit Polyclonal Anti-C17orf80 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C17orf80 antibody: synthetic peptide directed towards the N terminal of human C17orf80. Synthetic peptide located within the following region: MSDNPPRMEVCPYCKKPFKRLKSHLPYCKMIGPTIPTDQKVYQSKPATLP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 67 kDa
• Gene Name: chromosome 17 open reading frame 80
• Database Link:
  NP_060411
  Q9BSJ5
• Background: The exact function of C17orf80 remains unknown.
• Synonyms: HLC-8; MIG3; SPEP1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 92%; Zebrafish: 77%

Reference Data

• Protein Families: Transmembrane