OriGene Logo

CLN6 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA342045
Rabbit Polyclonal Anti-CLN6 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY402624 Transient overexpression lysate of ceroid-lipofuscinosis, neuronal 6, late infantile, variant (CLN6) 100 ug
$436.00
TP301904 Recombinant protein of human ceroid-lipofuscinosis, neuronal 6, late infantile, variant (CLN6), 20 µg
20 ug
$867.00

View other "CLN6 or NM_017882" antibodies

Specifications
Specifications
Product Data
Application IHC, WB
Recommended Dilution WB, IHC
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CLN6 antibody: synthetic peptide directed towards the C terminal of human CLN6. Synthetic peptide located within the following region: RLFLDSNGLFLFSSFALTLLLVALWVAWLWNDPVLRKKYPGVIYVPEPWA
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 36 kDa
Gene Name ceroid-lipofuscinosis, neuronal 6, late infantile, variant
Database Link
Background This gene is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children.The genes responsible likely encode proteins involved inThe degradation of post-translationally modified proteins in lysosomes.The primary defect in NCL disorders is thought to be associated with lysosomal storage function. provided by RefSeq, Oct 2008
Synonyms CLN4A; HsT18960; nclf
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 86%
Reference Data
Protein Categories Intracellular Proteins, Membrane Proteins
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.