QPCTL Rabbit Polyclonal Antibody

SKU TA342033

Rabbit Polyclonal Anti-QPCTL Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-QPCTL antibody: synthetic peptide directed towards the middle region of human QPCTL. Synthetic peptide located within the following region: QLLFLDGEEALKEWGPKDSLYGSRHLAQLMESIPHSPGPTRIQAIELFML
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 43 kDa
• Gene Name: glutaminyl-peptide cyclotransferase-like
• Database Link:
  NP_060129
  Q9NXS2
• Background: QPCTL is a single-pass membrane proteinPotential. It belongs toThe glutaminyl-peptide cyclotransferase family.The exact function of QPCTL remains unknown.
• Synonyms: gQC
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Rabbit: 93%; Pig: 92%; Guinea pig: 92%; Horse: 86%

Reference Data

• Protein Families: Protease, Transmembrane