PTPLAD1 (HACD3) Rabbit Polyclonal Antibody

SKU TA342011

Rabbit Polyclonal Anti-PTPLAD1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PTPLAD1 antibody: synthetic peptide directed towards the N terminal of human PTPLAD1. Synthetic peptide located within the following region: WLDESDAEMELRAKEEERLNKLRLESEGSPETLTNLRKGYLFMYNLVQFL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 43 kDa
• Gene Name: 3-hydroxyacyl-CoA dehydratase 3
• Database Link:
  NP_057479
  Q9P035
• Background: PTPLAD1 is a multi-pass membrane protein. It belongs toThe PTPLA family and contains 1 CS domain. PTPLAD1 (hB-ind1) plays a crucial role in HCV RNA replication andThe propagation of JFH1 virus through interaction with viral and host proteins. It is involved in Rac1-signaling pathways leading toThe modulation of gene expression.
• Synonyms: B-IND1; BIND1; HSPC121; PTPLAD1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 93%

Reference Data

• Protein Families: Transmembrane