A4GNT Rabbit Polyclonal Antibody

SKU TA342001

Rabbit Polyclonal Anti-A4GNT Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-A4GNT antibody: synthetic peptide directed towards the C terminal of human A4GNT. Synthetic peptide located within the following region: NISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 39 kDa
• Gene Name: alpha-1,4-N-acetylglucosaminyltransferase
• Database Link:
  NP_057245
  Q9UNA3
• Background: This gene encodes a protein fromThe glycosyltransferase 32 family.The enzyme catalyzesThe transfer of N-acetylglucosamine (GlcNAc) to core 2 branched O-glycans. It forms a unique glycan, GlcNAcalpha1-->4Galbeta-->R and is largely associated withThe Golgi apparatus membrane. [provided by RefSeq, Jul 2008]
• Synonyms: alpha4GnT
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Dog: 93%; Rabbit: 93%; Mouse: 92%; Bovine: 92%; Guinea pig: 92%; Horse: 79%

Reference Data

• Protein Families: Transmembrane