PIGT Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PIGT antibody: synthetic peptide directed towards the N terminal of human PIGT. Synthetic peptide located within the following region: PLPSGDVAATFQFRTRWDSELQREGVSHYRLFPKALGQLISKYSLRELHL |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 64 kDa |
Gene Name | phosphatidylinositol glycan anchor biosynthesis class T |
Database Link | |
Background | This gene encodes a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis.The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins toThe cell surface.This protein is an essential component ofThe multisubunit enzyme, GPI transamidase. GPI transamidase mediates GPI anchoring inThe endoplasmic reticulum, by catalyzingThe transfer of fully assembled GPI units to proteins. Alternatively spliced transcript variants encoding multiple isoforms have been observed forThis gene. [provided by RefSeq, May 2012] |
Synonyms | CGI-06; MCAHS3; NDAP; PNH2 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Rabbit: 86% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | Glycosylphosphatidylinositol(GPI)-anchor biosynthesis, Metabolic pathways |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.