OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

COQ2 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA341982
Rabbit Polyclonal Anti-COQ2 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (1)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00

View other "COQ2 or NM_015697" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-COQ2 antibody: synthetic peptide directed towards the middle region of human COQ2. Synthetic peptide located within the following region: FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAML
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 42 kDa
Gene Name coenzyme Q2, polyprenyltransferase
Database Link
Background This gene encodes an enzyme that functions inThe final steps inThe biosynthesis of CoQ (ubiquinone), a redox carrier inThe mitochondrial respiratory chain and a lipid-soluble antioxidant.This enzyme, which is part ofThe coenzyme Q10 pathway, catalyzesThe prenylation of parahydroxybenzoate with an all-trans polyprenyl group. Mutations inThis gene cause coenzyme Q10 deficiency, a mitochondrial encephalomyopathy, and also COQ2 nephropathy, an inherited form of mitochondriopathy with primary renal involvement. provided by RefSeq, Oct 2009
Synonyms CL640; COQ10D1; MSA1
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rabbit: 93%; Yeast: 91%; Pig: 86%; Rat: 86%; Mouse: 86%; Zebrafish: 86%; Goat: 79%; Horse: 79%
Reference Data
Protein Families Transmembrane
Protein Pathways Ubiquinone and other terpenoid-quinone biosynthesis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

β-Resorcylic acid prevents MASLD in ob/ob mice by modulating lipid metabolism and inflammation in the liver
López-Herrador, Torres-Rusillo, González-García et al
Pharmacol Res (2025) 219, 107906 DOI: 10.1016/j.phrs.2025.107906
Cited by 3
Snippet: Western blot analyses in WAT were performed following the methodology described in Diaz-Casado ME. et al. [29], using the following primary antibodies: anti-COQ2 (Origene, TA341982), anti-COQ4 (Proteintech, 16654–1-AP), anti-COQ5 (Proteintech, 17453-AP), anti-COQ7 (Proteintech, 15083–1-AP), anti-TOM20 (Proteintech, 11802–1-AP)
WB
4-Hydroxybenzoic acid rescues multisystemic disease and perinatal lethality in a mouse model of mitochondrial disease
Corral-Sarasa, Martínez-Gálvez, González-García et al
Cell Rep (2024) 43 (5), 114148 DOI: 10.1016/j.celrep.2024.114148
Cited by 20
AI Summary: In this study, OriGene’s anti-COQ2 antibody (Cat# TA341982) was used to detect COQ2 protein levels, helping to assess the impact of 4-hydroxybenzoic acid supplementation on CoQ biosynthesis and mitochondrial function in the mouse model.
Snippet: COQ2 Origene/Quimigen Cat# TA341982;RRID: AB_3096491 COQ5 Novus Biologicals Cat# NBP2-82738;RRID: AB_3096493 COQ4 Proteintech Cat# 16654-1-AP;RRID: AB_2878296
The Q-junction and the inflammatory response are critical pathological and therapeutic factors in CoQ deficiency
González-García, Díaz-Casado, Hidalgo-Gutiérrez et al
Redox Biol (2022) 55, 102403 DOI: 10.1016/j.redox.2022.102403
Cited by 13
AI Summary: OriGene's anti-COQ2 antibody (TA341982) was used in this study to detect COQ2 protein levels, contributing to the analysis of mitochondrial protein changes in CoQ-deficient mice.
Snippet: drial proteins and to β-actin for cytosolic proteins. The data were expressed in terms of percent relative to wild-type mice or control cells. The following primary antibodies were used: anti-COQ2 (Origene, TA341982), anti-COQ4 (Proteintech, 16654-1-AP), anti-COQ5 (Proteintech, 17453-AP), anti-COQ7 (Proteintech, 15083-1-AP), anti-PRODH (Cell Signaling, #22980), anti-OPA1 (Cell Signaling, #27733)
FigureFigureFigure
WB
β-RA reduces DMQ/CoQ ratio and rescues the encephalopathic phenotype in Coq9 R239X mice
Hidalgo-Gutiérrez, Barriocanal-Casado, Bakkali et al
EMBO Mol Med (2018)
AI Summary: OriGene's anti-COQ2 antibody (TA341982) was used in this study to detect COQ2 protein levels, contributing to the analysis of CoQ biosynthetic pathway components in the Coq9 R239X mouse model.
Snippet: _et al_, 2015, 2017). The following primary antibodies were used: anti‐SQRDL (Proteintech, 17256‐1‐AP, dilution 1:500), anti‐PDSS2 (Proteintech, 13544‐1‐AP, dilution 1:500), anti‐COQ2 (Origene, TA341982, dilution 1:2,500), anti‐COQ4 (Proteintech, 16654‐1‐AP, dilution 1:2,000), anti‐COQ5 (Proteintech, 17453‐1‐AP, dilution 1:1,000), anti‐COQ6 (Proteintech, 12481‐1‐AP
Showing 1-4 of 4 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products