COQ2 Rabbit Polyclonal Antibody

SKU TA341982

Rabbit Polyclonal Anti-COQ2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-COQ2 antibody: synthetic peptide directed towards the middle region of human COQ2. Synthetic peptide located within the following region: FSGVMWTLIYDTIYAHQDKRDDVLIGLKSTALRFGENTKPWLSGFSVAML
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 42 kDa
• Gene Name: coenzyme Q2, polyprenyltransferase
• Database Link:
  NP_056512
• Background: This gene encodes an enzyme that functions inThe final steps inThe biosynthesis of CoQ (ubiquinone), a redox carrier inThe mitochondrial respiratory chain and a lipid-soluble antioxidant.This enzyme, which is part ofThe coenzyme Q10 pathway, catalyzesThe prenylation of parahydroxybenzoate with an all-trans polyprenyl group. Mutations inThis gene cause coenzyme Q10 deficiency, a mitochondrial encephalomyopathy, and also COQ2 nephropathy, an inherited form of mitochondriopathy with primary renal involvement. [provided by RefSeq, Oct 2009]
• Synonyms: CL640; COQ10D1; MSA1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rabbit: 93%; Yeast: 91%; Pig: 86%; Rat: 86%; Mouse: 86%; Zebrafish: 86%; Goat: 79%; Horse: 79%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Ubiquinone and other terpenoid-quinone biosynthesis