ATL3 Rabbit Polyclonal Antibody

SKU TA341979

Rabbit Polyclonal Anti-DKFZP564J0863 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DKFZP564J0863 antibody: synthetic peptide directed towards the middle region of human DKFZP564J0863. Synthetic peptide located within the following region: DHFKKTKKMGGKDFSFRYQQELEEEIKELYENFCKHNGSKNVFSTFRTPA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 60 kDa
• Gene Name: atlastin GTPase 3
• Database Link:
  NP_056274
  Q6DD88
• Background: This gene encodes a member of a family of dynamin-like, integral membrane GTPases.The encoded protein is required forThe proper formation ofThe network of interconnected tubules ofThe endoplasmic reticulum. Mutations inThis gene may be associated with hereditary sensory neuropathy type IF. Alternatively spliced transcript variants that encode distinct isoforms have been described. [provided by RefSeq, Feb 2014]
• Synonyms: HSN1F
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%

Reference Data

• Protein Families: Transmembrane