OriGene Logo

PTDSS1 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA341954
Rabbit Polyclonal Anti-PTDSS1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
2 Weeks*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY415052 Transient overexpression lysate of phosphatidylserine synthase 1 (PTDSS1) 100 ug
$436.00
TP301012 Recombinant protein of human phosphatidylserine synthase 1 (PTDSS1), 20 µg
20 ug
$737.00

View other "PTDSS1 or NM_014754" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PTDSS1 antibody: synthetic peptide directed towards the N terminal of human PTDSS1. Synthetic peptide located within the following region: MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITIDFFYRPHTITLLSFTI
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 55 kDa
Gene Name phosphatidylserine synthase 1
Database Link
Background The protein encoded byThis gene catalyzesThe formation of phosphatidylserine from either phosphatidylcholine or phosphatidylethanolamine. Phosphatidylserine localizes toThe mitochondria-associated membrane ofThe endoplasmic reticulum, where it serves a structural role as well as a signaling role. Defects inThis gene are a cause of Lenz-Majewski hyperostotic dwarfism. Two transcript variants encoding different isoforms have been found forThis gene. provided by RefSeq, Mar 2014
Synonyms LMHD; PSS1; PSSA
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 91%
Reference Data
Protein Categories Membrane Proteins
Protein Families Transmembrane
Protein Pathways Glycerophospholipid metabolism, Metabolic pathways
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.